Cd160 (NM_018767) Mouse Tagged ORF Clone

CAT#: MG216467

  • TrueORF®

Cd160 (tGFP-tagged) - Mouse CD160 antigen (Cd160) transcript variant 2, (10ug)

ORF Plasmid: DDK tGFP



  "NM_018767" in other vectors (5)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms AU045688; By55
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG216467 representing NM_018767
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAAAGAATCCTGATGGCCCCTGGCCAAAGCTGCTGTGCCCTGGCCATCCTGCTGGCAATTGTGAACT
TCCAACATGGTGGATGTATTCATGTCACCAGCTCAGCATCCCAGAAAGGAGGGCGACTGGACCTCACCTG
TACTTTGTGGCACAAGAAAGACGAAGCTGAGGGGCTAATACTCTTCTGGTGCAAAGACAATCCTTGGAAC
TGTTCCCCTGAGACCAGCTTAGAACAGCTTAGGGTTAAAAGGGATCCTGAGACAGATGGCATCACTGAAA
AGTCATCTCAGTTGGTGTTCACCATAGAACAAGCTACACCATCAGACAGTGGGACCTACCAGTGCTGTGC
CAGAAGCCAGAAACCAGAAATCTACATTCATGGCCACTTTCTCTCCGTTCTAGTCACAGGGAACCACACA
GAGATAAGACAGAGACAAAGGTCACACCCTGACTTCAGCCATATCAACGGCACTCTCAGTTCAGGCTTCC
TGCAAGTAAAGGCTTGGGGGATGTTGGTCACCAGCCTGGTGGCCCTTCAAGCTCTATATACCTTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG216467 representing NM_018767
Red=Cloning site Green=Tags(s)

MQRILMAPGQSCCALAILLAIVNFQHGGCIHVTSSASQKGGRLDLTCTLWHKKDEAEGLILFWCKDNPWN
CSPETSLEQLRVKRDPETDGITEKSSQLVFTIEQATPSDSGTYQCCARSQKPEIYIHGHFLSVLVTGNHT
EIRQRQRSHPDFSHINGTLSSGFLQVKAWGMLVTSLVALQALYTL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018767
ORF Size 555 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq NM_018767.2
RefSeq Size 2513 bp
RefSeq ORF 558 bp
Locus ID 54215
UniProt ID O88875
Gene Summary CD160 antigen: Receptor on immune cells capable to deliver stimulatory or inhibitory signals that regulate cell activation and differentiation. Exists as a GPI-anchored and as a transmembrane form, each likely initiating distinct signaling pathways via phosphoinositol 3-kinase in activated NK cells and via LCK and CD247/CD3 zeta chain in activated T cells (By similarity). Receptor for both classical and non-classical MHC class I molecules (PubMed:16177084). Receptor or ligand for TNF superfamily member TNFRSF14, participating in bidirectional cell-cell contact signaling between antigen presenting cells and lymphocytes. Upon ligation of TNFRSF14, provides stimulatory signal to NK cells enhancing IFNG production and anti-tumor immune response (PubMed:25711213). On activated CD4+ T cells, interacts with TNFRSF14 and downregulates CD28 costimulatory signaling, restricting memory and alloantigen-specific immune response (By similarity). In the context of bacterial infection, acts as a ligand for TNFRSF14 on epithelial cells, triggering the production of antimicrobial proteins and proinflammatory cytokines (PubMed:22801499).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...