Psen1 (BC014744) Mouse Tagged ORF Clone

CAT#: MG203433

  • TrueORF®

Psen1 (tGFP-tagged) - Mouse presenilin 1 (cDNA clone MGC:25288 IMAGE:4511140)

ORF Plasmid: DDK tGFP



  "BC014744" in other vectors (3)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,850.00


货期*
4周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms PS1, S182, PS-1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG203433 representing BC014744
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGAGATACCTGCACCTTTGTCCTACTTCCAGAATGCCCAGATGTCTGAGGACAGCCACTCCAGCA
GCGCCATCCGGAGCCAGAATGACAGCCAAGAACGGCAGCAGCAGCATGACAGGCAGAGACTTGACAACCC
TGAGCCAATATCTAATGGGCGGCCCCAGAGTAACTCAAGACAGGTGGTGGAACAAGATGAGGAGGAAGAC
GAAGAGCTGACATTGAAATATGGAGCCAAGCATGTCATCATGCTCTTTGTCCCCGTGACCCTCTGCATGG
TCGTCGTCGTGGCCACCATCAAATCAGTCAGCTTCTATACCCGGAAGGACGGTCAGCTAATCTACACCCC
ATTCACAGAAGACACTGAGACTGTAGGCCAAAGAGCCCTGCACTCGATCCTGAATGCGGCCATCATGATC
AGTGTCATTGTCATTATGACCATCCTCCTGGTGGTCCTGTATAAATACAGGTGCTACAAGGTCATCCACG
CCTGGCTTATTATTTCATCTCTGTTGTTGCTGTTCTTTTTTTCGTTCATTTACTTAGGGGAAGTATTTAA
GACCTACAATGTCGCCGTGGACTACGTTACAGTAGCACTCCTAATCTGGAATTTTGGTGTGGTCGGGATG
ATTGCCATCCACTGGAAAGGCCCCCTTCGACTGCAGCAGGCGTATCTCATTATGATCAGTGCCCTCATGG
CCCTGGTATTTATCAAGTACCTCCCCGAATGGACCGCATGGCTCATCTTGGCTGTGATTTCAGTATATGG
TAAAGCTCAAGAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG203433 representing BC014744
Red=Cloning site Green=Tags(s)

MTEIPAPLSYFQNAQMSEDSHSSSAIRSQNDSQERQQQHDRQRLDNPEPISNGRPQSNSRQVVEQDEEED
EELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTEDTETVGQRALHSILNAAIMI
SVIVIMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFIYLGEVFKTYNVAVDYVTVALLIWNFGVVGM
IAIHWKGPLRLQQAYLIMISALMALVFIKYLPEWTAWLILAVISVYGKAQD

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC014744
ORF Size 785 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq BC014744, AAH14744
RefSeq Size 1982 bp
RefSeq ORF 785 bp
Locus ID 19164
Gene Summary Catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (amyloid-beta precursor protein). Requires the presence of the other members of the gamma-secretase complex for protease activity (By similarity). Plays a role in Notch and Wnt signaling cascades and regulation of downstream processes via its role in processing key regulatory proteins, and by regulating cytosolic CTNNB1 levels (PubMed:10421573, PubMed:11517342). Stimulates cell-cell adhesion via its interaction with CDH1; this stabilizes the complexes between CDH1 (E-cadherin) and its interaction partners CTNNB1 (beta-catenin), CTNND1 and JUP (gamma-catenin) (PubMed:11226248). Under conditions of apoptosis or calcium influx, cleaves CDH1 (PubMed:11953314). This promotes the disassembly of the complexes between CDH1 and CTNND1, JUP and CTNNB1, increases the pool of cytoplasmic CTNNB1, and thereby negatively regulates Wnt signaling (PubMed:11226248). Required for normal embryonic brain and skeleton development, and for normal angiogenesis (PubMed:9160754, PubMed:10421573, PubMed:12834865). Mediates the proteolytic cleavage of EphB2/CTF1 into EphB2/CTF2 (PubMed:17428795). The holoprotein functions as a calcium-leak channel that allows the passive movement of calcium from endoplasmic reticulum to cytosol and is involved in calcium homeostasis (PubMed:16959576). Involved in the regulation of neurite outgrowth (By similarity). Is a regulator of presynaptic facilitation, spike transmission and synaptic vesicles replenishment in a process that depends on gamma-secretase activity. It acts through the control of SYT7 presynaptic expression (PubMed:30429473).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...