ADM2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS
Specificity	Expected reactivity: Cow, Horse, Human, Mouse, Pig, Rat Homology: Cow: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 83%; Rat: 93%
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Predicted Protein Size	16 kDa
Gene Name	adrenomedullin 2
Database Link	NP_001240774 Entrez Gene 79924 Human UniProt ID Q7Z4H4
Background	This gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues, acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Synonyms	AM2; dJ579N16.4; FLJ21135; intermedin; OTTHUMP00000196596
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.