RHCG Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the following sequence QSKERQNSVYQSDLFAMIGTLFLWMYWPSFNSAISYHGDSQHRAAINTYC
Specificity	Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish Homology: Cow: 86%; Dog: 79%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 79%; Rat: 86%; Sheep: 86%; Zebrafish: 86%
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Predicted Protein Size	53 kDa
Gene Name	Rh family C glycoprotein
Database Link	NP_057405 Entrez Gene 51458 Human UniProt ID Q9UBD6
Synonyms	C15orf6; CDRC2; PDRC2; RHGK; SLC42A3
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.