MATN1 Rabbit Polyclonal Antibody
CAT#: TA346860
Rabbit Polyclonal Anti-MATN1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MATN1 antibody: synthetic peptide directed towards the middle region of human MATN1. Synthetic peptide located within the following region: KYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 54 kDa |
Gene Name | matrilin 1, cartilage matrix protein |
Database Link | |
Background | This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins are thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. Mutations of this gene ha |
Synonyms | CMP; CRTM |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |