B3GNT4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-B3GNT4 antibody: synthetic peptide directed towards the N terminal of human B3GNT4. Synthetic peptide located within the following region: MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Database Link	NP_110392 Entrez Gene 79369 Human UniProt ID Q9C0J1
Background	This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein. [provided by RefSeq, Jul 2008]
Synonyms	B3GN-T4; beta3Gn-T4
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Horse: 93%; Pig: 92%; Rat: 86%; Mouse: 86%
Reference Data
Protein Pathways	Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.