Pomgnt1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Pomgnt1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	75 kDa
Gene Name	protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase
Database Link	NP_080927 Entrez Gene 68273 Mouse UniProt ID Q91X88
Background	Participates in O-mannosyl glycosylation. May be responsible for the synthesis of the GlcNAc(beta1-2)Man(alpha1-)O-Ser/Thr moiety on alpha-dystroglycan and other O-mannosylated proteins. Is specific for alpha linked terminal mannose.
Synonyms	DKFZp761B182; FLJ20277; GNTI.2; MEB; MGAT1.2
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.