NAT9 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NAT9 antibody: synthetic peptide directed towards the N terminal of human NAT9. Synthetic peptide located within the following region: MRLNQNTLLLGKKVVLVPYTSEHVPSRYHEWMKSEELQRLTASEPLTLEQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	N-acetyltransferase 9 (putative)
Database Link	NP_056469 Entrez Gene 26151 Human UniProt ID Q9BTE0
Background	The function of this protein remains unknown.
Synonyms	EBSP; hNATL
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Goat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.