St8sia4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-St8sia4 antibody is: synthetic peptide directed towards the C-terminal region of Rat St8sia4. Synthetic peptide located within the following region: GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 4
Database Link	NP_446366 Entrez Gene 116696 Rat
Background	enzyme involved in polysialylation of N-CAM [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: AM419015.1, U90215.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS160565, ERS240718 [ECO:0000348] ##Evidence-Data-END##
Synonyms	MGC34450; MGC61459; polysialyltransferase-1; PST; PST1; SIAT8D; ST8SIA-IV
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 93%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.