Eci1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-DCI antibody is: synthetic peptide directed towards the C-terminal region of Human DCI. Synthetic peptide located within the following region: QWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSFISKDSIQKSLQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	enoyl-CoA delta isomerase 1
Database Link	NP_059002 Entrez Gene 1632 Human
Background	catalyzes the interconversion of 3-cis-dodecenoyl-CoA and 2-trans-dodecenoyl-CoA in fatty acid beta oxidation [RGD, Feb 2006]. ##Evidence-Data-START## Transcript exon combination :: BC078705.1, D00729.1 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS160522, ERS240727 [ECO:0000348] ##Evidence-Data-END## ##RefSeq-Attributes-START## gene product(s) localized to mito. :: inferred from homology ##RefSeq-Attributes-END##
Synonyms	Dci; eci
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.