NAA60 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NAT15 antibody: synthetic peptide directed towards the middle region of human NAT15. Synthetic peptide located within the following region: DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	N(alpha)-acetyltransferase 60, NatF catalytic subunit
Database Link	NP_001077070 Entrez Gene 79903 Human UniProt ID Q9H7X0
Background	The function of this protein remains unknown.
Synonyms	HAT4; NAT15
Note	Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Rat: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Dog: 79%; Goat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.