NAA60 Rabbit Polyclonal Antibody

CAT#: TA346700

Rabbit Polyclonal Anti-NAT15 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 2
    • 100 ug

CNY 3,080.00


Recombinant protein of human N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of N-acetyltransferase 15 (GCN5-related, putative) (NAT15), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-NAT15 antibody: synthetic peptide directed towards the middle region of human NAT15. Synthetic peptide located within the following region: DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 27 kDa
Gene Name N(alpha)-acetyltransferase 60, NatF catalytic subunit
Background The function of this protein remains unknown.
Synonyms HAT4; NAT15
Note Immunogen Sequence Homology: Human: 100%; Zebrafish: 100%; Rat: 93%; Rabbit: 93%; Pig: 86%; Guinea pig: 86%; Dog: 79%; Goat: 79%; Horse: 79%; Mouse: 79%; Bovine: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...