SLC38A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	IHC, WB
Reactivity	Human, Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC38A3 antibody: synthetic peptide directed towards the N terminal of human SLC38A3. Synthetic peptide located within the following region: GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	56 kDa
Gene Name	solute carrier family 38 member 3
Database Link	NP_006832 Entrez Gene 76257 MouseEntrez Gene 10991 Human UniProt ID Q99624
Background	As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and£íay play a role in nitrogen metabolism and synaptic transmission.
Synonyms	G17; NAT1; SN1; SNAT3
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Sheep: 86%; Guinea pig: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.