Follistatin (FST) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FST antibody: synthetic peptide directed towards the middle region of human FST. Synthetic peptide located within the following region: ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	follistatin
Database Link	NP_006341 Entrez Gene 10468 Human UniProt ID P19883
Background	Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
Synonyms	FS
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 93%; Goat: 92%; Bovine: 92%; Zebrafish: 77%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	TGF-beta signaling pathway

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.