Follistatin (FST) Rabbit Polyclonal Antibody

CAT#: TA346429

Rabbit Polyclonal Anti-FST Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human follistatin (FST), transcript variant FST344, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of follistatin (FST), transcript variant FST344
    • 100 ug

CNY 3,080.00


Recombinant protein of human follistatin (FST), transcript variant FST317, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of follistatin (FST), transcript variant FST317
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-FST antibody: synthetic peptide directed towards the middle region of human FST. Synthetic peptide located within the following region: ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name follistatin
Background Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.
Synonyms FS
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Rabbit: 100%; Guinea pig: 93%; Goat: 92%; Bovine: 92%; Zebrafish: 77%
Reference Data
Protein Families Druggable Genome, Secreted Protein
Protein Pathways TGF-beta signaling pathway
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...