SPRR3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPRR3 antibody: synthetic peptide directed towards the middle region of human SPRR3. Synthetic peptide located within the following region: DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	small proline rich protein 3
Database Link	NP_005407 Entrez Gene 6707 Human UniProt ID Q9UBC9
Background	SPRR3 is the cross-linked envelope protein of keratinocytes.
Synonyms	esophagin; OTTHUMP00000015757; small proline-rich protein 3
Note	Immunogen Sequence Homology: Human: 100%; Rat: 92%; Mouse: 86%; Bovine: 86%; Rabbit: 85%; Pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.