CES2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CES2 antibody: synthetic peptide directed towards the C terminal of human CES2. Synthetic peptide located within the following region: HWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKKALPQKIQELEEPEERH
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	69 kDa
Gene Name	carboxylesterase 2
Database Link	NP_003860 Entrez Gene 8824 Human UniProt ID O00748
Background	Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system.Carboxylesterase 2 is a member of a large multigene family. The enzymes encoded by these genes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters. The specific function of this enzyme has not yet been determined; however, it is speculated that carboxylesterases may play a role in lipid metabolism and/or the blood-brain barrier system. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Synonyms	CE-2; CES2A1; iCE; PCE-2
Note	Immunogen Sequence Homology: Human: 100%; Dog: 83%; Pig: 83%; Rat: 83%; Mouse: 83%; Guinea pig: 83%
Reference Data
Protein Families	Druggable Genome
Protein Pathways	Drug metabolism - other enzymes

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.