Transglutaminase 4 (TGM4) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TGM4 antibody: synthetic peptide directed towards the N terminal of human TGM4. Synthetic peptide located within the following region: KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	77 kDa
Gene Name	transglutaminase 4
Database Link	NP_003232 Entrez Gene 7047 Human UniProt ID P49221
Background	TGM4 is associated with the mammalian reproductive process. TGM4 catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.
Synonyms	hTGP; TGP
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 83%; Zebrafish: 82%; Pig: 75%; Rat: 75%; Guinea pig: 75%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.