Ambp Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ambp antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: ATLESYVVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	alpha-1-microglobulin/bikunin precursor
Database Link	NP_037033 Entrez Gene 25377 Rat UniProt ID Q64240
Background	Inter-alpha-trypsin inhibitor inhibits trypsin, plasmin, and lysosomal granulocytic elastase. Inhibits calcium oxalate crystallization.Trypstatin is a trypsin inhibitor. It inhibits blood coagulation factor Xa and tryptase about 100-fold more rapidly than porcine pancreatic trypsin and chymase.
Synonyms	A1M; alpha-1-microglobulin/bikunin; bikunin; EDC1; HCP; HI30; IATIL; ITI; ITIL; ITILC; trypstatin; uristatin; UTI
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.