IGSF1 Rabbit Polyclonal Antibody

CAT#: TA346294

Rabbit Polyclonal Anti-IGSF1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (1)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the N terminal of human IGSF1. Synthetic peptide located within the following region: WLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGEDKPLQFLDATSIDD
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 149 kDa
Gene Name immunoglobulin superfamily member 1
Background Members of the immunoglobulin (Ig) superfamily, which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. Members of the immunoglobulin (Ig) superfamily (see MIM 147100), which includes IGSF1, have a variety of functions, but all appear to play a role in cell recognition and the regulation of cell behavior. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-227 AB058894.2 1-227 228-250 Y10523.1 173-195 251-1082 BC063884.1 235-1066 1083-1084 Y10523.1 1028-1029 1085-2690 BC063884.1 1069-2674 2691-3713 AF034198.1 2661-3683 3714-4492 BC063884.1 3698-4476
Synonyms CHTE; IGCD1; IGDC1; INHBP; p120; PGSF2
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Mouse: 92%; Dog: 86%; Horse: 86%; Bovine: 79%
Reference Data
Protein Families Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...