CYP4B1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Cyp4b1 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Cyp4b1. Synthetic peptide located within the following region: FRLYPPVPQVYRQLSKPVTFVDGRSLPAGSLISLHIYALHRNSAVWPDPE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	cytochrome P450 family 4 subfamily B member 1
Database Link	NP_000770 Entrez Gene 13120 Mouse UniProt ID P13584
Background	Cyp4b1 is responsible for mutagenic activation of 3-methoxy-4-aminoazobenzene (3-MeO-AAB); a potent procarcinogen. Cyp4b1 is also active on 2-aminofluorene and 2-aminoanthracene.
Synonyms	CYPIVB1; P-450HP
Note	Immunogen Sequence Homology: Human: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Goat: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome, P450, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.