Laminin 5 (LAMB3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-LAMB3 antibody: synthetic peptide directed towards the middle region of human LAMB3. Synthetic peptide located within the following region: ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	128 kDa
Gene Name	laminin subunit beta 3
Database Link	NP_000219 Entrez Gene 3914 Human UniProt ID Q13751
Background	The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5. Mutations in this gene cause epidermolysis bullosa junctional Herlitz type, and generalized atrophic benign epidermolysis bullosa, diseases that are characterized by blistering of the skin. Multiple alternatively spliced transcript variants that encode the same protein have been found for this gene. [provided by RefSeq, Jul 2008]
Synonyms	AI1A; BM600-125KDA; LAM5; LAMNB1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Bovine: 86%; Guinea pig: 86%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	ECM-receptor interaction, Focal adhesion, Pathways in cancer, Small cell lung cancer

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.