RACK1 Rabbit Polyclonal Antibody

CAT#: TA345945

Rabbit Polyclonal Anti-GNB2L1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 (GNB2L1)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 (GNB2L1), 20 µg
    • 20 ug

CNY 2,900.00


Recombinant protein of human guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 (GNB2L1), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-GNB2L1 antibody: synthetic peptide directed towards the C terminal of human GNB2L1. Synthetic peptide located within the following region: LEGKIIVDELKQEVISTSSKAEPPQCTSLAWSADGQTLFAGYTDNLVRVW
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 35 kDa
Gene Name receptor for activated C kinase 1
Background GNB2L1 seems to bind protein kinase C acting as an intracellular receptor to anchor the activated PKC to the cytoskeleton.
Synonyms Gnb2-rs1; GNB2L1; H12.3; HLC-7; PIG21
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...