GTP binding protein era homolog (ERAL1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ERAL1 antibody: synthetic peptide directed towards the middle region of human ERAL1. Synthetic peptide located within the following region: KVHTTRCQALGVITEKETQVILLDTPGIISPGKQKRHHLELSLLEDPWKS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	Era like 12S mitochondrial rRNA chaperone 1
Database Link	NP_005693 Entrez Gene 26284 Human UniProt ID O75616
Background	ERAL1 belongs to the era/mnmE GTP-binding protein family.
Synonyms	CEGA; ERA; ERA-W; ERAL1A; H-ERA; HERA-A; HERA-B
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.