SFPQ Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SFPQ antibody: synthetic peptide directed towards the N terminal of human SFPQ. Synthetic peptide located within the following region: VPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPHRGGGE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	78 kDa
Gene Name	splicing factor proline/glutamine-rich
Database Link	NP_005057 Entrez Gene 6421 Human UniProt ID P23246
Background	SFPQ is DNA- and RNA binding protein. It is essential pre-mRNA splicing factor required early in spliceosome formation and for splicing catalytic step II, probably as an heteromer with NONO. It binds to pre-mRNA in spliceosome C complex, and specifically binds to intronic polypyrimidine tracts. It interacts with U5 snRNA. It may be involved in a pre-mRNA coupled splicing and polyadenylation process as component of a snRNP-free complex with SNRPA/U1A. SFPQ may be involved in homologous DNA pairing. SFPQ is involved in transcriptional regulation. It binds the DNA sequence 5'-CTGAGTC-3' in the insulin-like growth factor response element (IGFRE) and inhibits IGF-I-stimulated transcriptional activity.
Synonyms	POMP100; PPP1R140; PSF
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Rat: 79%; Mouse: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.