HCM (RNMT) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RNMT antibody: synthetic peptide directed towards the N terminal of human RNMT. Synthetic peptide located within the following region: ETEDVPKDKSSTGDGTQNKRKIALEDVPEKQKNLEEGHSSTVAAHYNELQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	55 kDa
Gene Name	RNA guanine-7 methyltransferase
Database Link	NP_003790 Entrez Gene 8731 Human UniProt ID O43148
Background	RNMT belongs to the mRNA cap methyltransferase family. RNMT is a mRNA-capping methyltransferase that methylates the N7 position of the added guanosine to the 5'-cap structure of mRNAs. It binds RNA containing 5'-terminal GpppC.
Synonyms	cm1p; CMT1; CMT1c; hCMT1; hMet; MET; Met; RG7MT1
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 93%; Pig: 86%; Guinea pig: 86%; Horse: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.