EIF3B Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EIF3S9 antibody: synthetic peptide directed towards the C terminal of human EIF3S9. Synthetic peptide located within the following region: YRKMAQELYMEQKNERLELRGGVDTDELDSNVDDWEEETIEFFVTEEIIP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	90 kDa
Gene Name	eukaryotic translation initiation factor 3 subunit B
Database Link	NP_003742 Entrez Gene 8662 Human UniProt ID P55884
Background	EIF3S9 binds to the 40S ribosome and promotes the binding of methionyl-tRNAi and mRNA.
Synonyms	EIF3-ETA; EIF3-P110; EIF3-P116; EIF3S9; PRT1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Bovine: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.