KIAA0020 (PUM3) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KIAA0020 antibody: synthetic peptide directed towards the middle region of human KIAA0020. Synthetic peptide located within the following region: PAHTVREIIEVLQKGDGNAHSKKDTEVRRRELLESISPALLSYLQEHAQE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	71 kDa
Gene Name	pumilio RNA binding family member 3
Database Link	NP_001026861 Entrez Gene 9933 Human UniProt ID Q15397
Background	KIAA0020 contains 6 pumilio repeats and 1PUM-HD domain. The function remains unknown.
Synonyms	HBV X-transactivated gene 5 protein; HLA-HA8; KIAA0020 protein; MGC8749; minor histocompatibility antigen HA-8; PEN; penguin homolog; protein 5 transactivated by hepatitis B virus X antigen (HBxAg); PUF6; RP11-526D20.2; XTP5
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.