CARS1 Rabbit Polyclonal Antibody
CNY 5,250.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-CARS antibody is: synthetic peptide directed towards the N-terminal region of Human CARS. Synthetic peptide located within the following region: ADSSGQQAPDYRSILSISDEAARAQALNEHLSTRSYVQGYSLSQADVDAF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 91 kDa |
Gene Name | cysteinyl-tRNA synthetase |
Database Link | |
Background | CARS is a class 1 aminoacyl-tRNA synthetase, cysteinyl-tRNA synthetase. Each of the twenty aminoacyl-tRNA synthetases catalyzes the aminoacylation of a specific tRNA or tRNA isoaccepting family with the cognate amino acid. CARS gene is one of several located near the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. |
Synonyms | CARS1; CYSRS; MGC:11246 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rat: 86%; Rabbit: 86%; Pig: 79%; Mouse: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Aminoacyl-tRNA biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |