RNF34 Rabbit Polyclonal Antibody
CAT#: TA345656
Rabbit Polyclonal Anti-RNF34 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 2 publications. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RNF34 antibody: synthetic peptide directed towards the middle region of human RNF34. Synthetic peptide located within the following region: LVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFFSNYTAPSATMSS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 42 kDa |
Gene Name | ring finger protein 34 |
Database Link | |
Background | RNF34 contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis.The protein encoded by this gene contains a RINF finger, a motif known to be involved in protein-protein and protein-DNA interactions. This protein interacts with DNAJA3/hTid-1, which is a DnaJ protein reported to function as a modulator of apoptosis. Overexpression of this gene in Hela cells was shown to confer the resistance to TNF-alpha induced apoptosis, suggesting an anti-apoptotic function of this protein. This protein can be cleaved by caspase-3 during the induction of apoptosis. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Synonyms | CARP-1; CARP1; hRFI; RFI; RIF; RIFF |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 87%; Pig: 80%; Rabbit: 80%; Guinea pig: 80% |
Reference Data | |
Protein Families | Druggable Genome |
Citations (2)
The use of this Antibodies has been cited in the following citations: |
---|
RNF34 ablation promotes cerebrovascular remodeling and hypertension by increasing NADPH-derived ROS generation
,Fang, S;Cheng, Y;Deng, F;Zhang, B;,
Neurobiology of disease
,PubMed ID 34015492
[RNF34]
|
RNF34 overexpression exacerbates neurological deficits and brain injury in a mouse model of intracerebral hemorrhage by potentiating mitochondrial dysfunction-mediated oxidative stress
,Qu, X;Wang, N;Chen, W;Qi, M;Xue, Y;Cheng, W;,
Sci Rep
,PubMed ID 31704983
[RNF34]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |