EVX2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EVX2 antibody: synthetic peptide directed towards the middle region of human EVX2. Synthetic peptide located within the following region: GGAGAGGGSDFGCSAAAPRSESGFLPYSAAVLSKTAVSPPDQRDEAPLTR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	48 kDa
Gene Name	even-skipped homeobox 2
Database Link	NP_001073927 Entrez Gene 344191 Human UniProt ID Q03828
Background	EVX2 belongs to the even-skipped homeobox family. It contains 1 homeobox DNA-binding domain.117-kb microdeletion removing HOXD9-HOXD13 and EVX2 causes synpolydactyly.
Synonyms	EVX-2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Zebrafish: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.