ZNF707 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF707 antibody: synthetic peptide directed towards the N terminal of human ZNF707. Synthetic peptide located within the following region: EPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	43 kDa
Gene Name	zinc finger protein 707
Database Link	NP_776192 Entrez Gene 286075 Human UniProt ID Q96C28
Background	ZNF707 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Synonyms	zinc finger protein 707
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%; Bovine: 85%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.