ZNF707 Rabbit Polyclonal Antibody
CAT#: TA345597
Rabbit Polyclonal Anti-ZNF707 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF707 antibody: synthetic peptide directed towards the N terminal of human ZNF707. Synthetic peptide located within the following region: EPSQRALYRDVMLDNFSSVAALGFCSPRPDLVSRLEQWEEPWVEDRERPE |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 43 kDa |
Gene Name | zinc finger protein 707 |
Database Link | |
Background | ZNF707 belongs to the krueppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation. |
Synonyms | zinc finger protein 707 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 93%; Dog: 85%; Pig: 85%; Rat: 85%; Mouse: 85%; Bovine: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |