MINA53 (MINA) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MINA antibody: synthetic peptide directed towards the N terminal of human MINA. Synthetic peptide located within the following region: MPKKAKPTGSGKEEGPAPCKQMKLEAAGGPSALNFDSPSSLFESLISPIK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	32 kDa
Gene Name	MYC induced nuclear antigen
Database Link	NP_694822 Entrez Gene 84864 Human UniProt ID Q8IUF8
Background	MINA is a protein with a molecular weight of 53 kDa, which is localized in the nucleus and with part of the protein concentrated in the nucleolus. It is a direct target gene of Myc and is involved in mammalian cell proliferation.
Synonyms	MDIG; MINA53; NO52; ROX
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 79%; Horse: 79%; Rabbit: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.