PARIS (ZNF746) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-ZNF746 antibody is: synthetic peptide directed towards the N-terminal region of Human ZNF746. Synthetic peptide located within the following region: PWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	zinc finger protein 746
Database Link	NP_001156946 Entrez Gene 155061 Human UniProt ID Q6NUN9
Background	ZNF746 may be involved in transcriptional regulation.
Synonyms	PARIS
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.