ZNF419A (ZNF419) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF419A antibody: synthetic peptide directed towards the C terminal of human ZNF419A. Synthetic peptide located within the following region: GRLFRENSSLVKHQRVHTGAKPYECRECGKFFRHNSSLFKHRRIHTGEMQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	59 kDa
Gene Name	zinc finger protein 419
Database Link	NP_078967 Entrez Gene 79744 Human UniProt ID Q96HQ0
Background	ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. ZNF419A may be involved in transcriptional regulation.
Synonyms	ZAPHIR; ZNF419A
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Rabbit: 92%; Mouse: 91%; Dog: 86%; Horse: 86%; Pig: 85%; Rat: 83%; Sheep: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.