ZNF419A (ZNF419) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF419 antibody: synthetic peptide directed towards the N terminal of human ZNF419. Synthetic peptide located within the following region: AAAALRDPAQVPVAADLLTDHEEGYVTFEDVAVYFSQEEWRLLDDAQRLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	58 kDa
Gene Name	zinc finger protein 419
Database Link	NP_078967 Entrez Gene 79744 Human UniProt ID Q96HQ0
Background	ZNF419A contains 1 KRAB domain and 11 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. NF419A may be involved in transcriptional regulation.
Synonyms	ZAPHIR; ZNF419A
Note	Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Horse: 83%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.