Bcl11a Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Bcl11a antibody is: synthetic peptide directed towards the N-terminal region of Rat Bcl11a. Synthetic peptide located within the following region: KREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	91 kDa
Gene Name	B-cell CLL/lymphoma 11A
Database Link	NP_001178612 Entrez Gene 305589 Rat
Background	The function of this protein remains unknown.
Synonyms	BCL11A-L; BCL11A-S; BCL11A-XL; CTIP1; EVI-9; EVI9; FLJ10173; FLJ34997; HBFQTL5; KIAA1809; ZNF856
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.