TUT1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TUT1 antibody: synthetic peptide directed towards the middle region of human TUT1. Synthetic peptide located within the following region: EGAGGGAGTRAGWLATEAQVTQELKGLSGGEERPETEPLLSFVASVSPAD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	94 kDa
Gene Name	terminal uridylyl transferase 1, U6 snRNA-specific
Database Link	NP_073741 Entrez Gene 64852 Human UniProt ID Q9H6E5
Background	TUT1 is a nucleotidyl transferase that functions as both a terminal uridylyltransferase and a nuclear poly(A) polymerase. TUT1 specifically adds and removes nucleotides from the 3' end of small nuclear RNAs and select mRNAs and may function in controlling gene expression and cell proliferation. TUT1 specifically catalyzes uridylylation of U6 snRNA (RNU6; MIM 180692) and is essential for cell proliferation (Trippe et al., 2006 [PubMed 16790842]). [supplied by OMIM]
Synonyms	PAPD2; RBM21; STARPAP; TUTase; URLC6
Note	Immunogen Sequence Homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.