Zfp148 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Zfp148 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Zfp148. Synthetic peptide located within the following region: MNIDDKLEGLFLKCGGIDEMQSSRAMVVMGGVSGQSAVSGELQESVLQDR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	87 kDa
Gene Name	zinc finger protein 148
Database Link	NP_035879 Entrez Gene 22661 Mouse UniProt ID Q61624
Background	The function of this protein remains unknown.
Synonyms	2210405J08Rik; AI480666; AW045217; BERF-1; BFCOL1; ZBP-89; Zbp-89; Znf148
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Bovine: 93%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.