Zinc finger protein 287 (ZNF287) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ZNF287 antibody: synthetic peptide directed towards the N terminal of human ZNF287. Synthetic peptide located within the following region: LASSKRMNSSSRSQILLRWKSDKAQSGPYNVEKEILTSRFLRDTETCRQN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	87 kDa
Gene Name	zinc finger protein 287
Database Link	NP_065704 Entrez Gene 57336 Human UniProt ID Q9HBT7
Background	ZNF287 is a member of the krueppel family of zinc finger proteins, suggesting a role as a transcription factor. Its specific function has not been determined. This gene encodes a member of the krueppel family of zinc finger proteins, suggesting a role as a transcription factor. Its specific function has not been determined. This gene is located near the Smith-Magenis syndrome region on chromosome 17.
Synonyms	ZKSCAN13; ZSCAN45
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 85%; Rat: 79%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.