ZNF302 Rabbit Polyclonal Antibody
CAT#: TA345254
Rabbit Polyclonal Anti-ZNF302 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZNF302 antibody: synthetic peptide directed towards the middle region of human ZNF302. Synthetic peptide located within the following region: FCCSSHLTQHQRIHSMKKKYECNKCLKVFSSFSFLVQHQSIHTEEKPFEV |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | zinc finger protein 302 |
Database Link | |
Background | ZNF302 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 7 C2H2-type zinc fingers and 1 KRAB domain. ZNF302 may be involved in transcriptional regulation. |
Synonyms | HSD16; MST154; MSTP154; ZNF135L; ZNF140L; ZNF327 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Guinea pig: 92%; Rabbit: 85% |
Reference Data | |
Protein Families | Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |