Klf3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Klf3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Klf3. Synthetic peptide located within the following region: MLMFDPVPVKQEAMDPVSVSFPSNYIESMKPNKYGVIYSTPLPDKFFQTP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	Kruppel-like factor 3 (basic)
Database Link	NP_032479 Entrez Gene 16599 Mouse UniProt ID Q60980
Background	Klf3 binds to the CACCC box of erythroid cell-expressed genes. It may play a role in hematopoiesis.
Synonyms	BKLF; MGC48279; TEF-2
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Guinea pig: 93%; Dog: 92%; Mouse: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.