PFKFB2 Rabbit Polyclonal Antibody
CAT#: TA345156
Rabbit Polyclonal Anti-PFKFB2 Antibody - C-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 300.00
CNY 1,430.00
CNY 4,840.00
CNY 3,080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Pfkfb2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 57 kDa |
Gene Name | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 |
Database Link | |
Background | Synthesis and degradation of fructose 2,6-bisphosphate. |
Synonyms | FBPase-2; PFK-2 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%; Yeast: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Fructose and mannose metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |