CRBN Rabbit Polyclonal Antibody
CAT#: TA345038
Rabbit Polyclonal Anti-CRBN Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 5,200.00
Cited in 1 publication. |
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-CRBN antibody: synthetic peptide directed towards the N terminal of human CRBN. Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 50 kDa |
Gene Name | cereblon |
Database Link | |
Background | This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutatio |
Synonyms | MRT2; MRT2A |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93% |
Reference Data | |
Protein Families | Protease |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Lenalidomide increases human dendritic cell maturation in multiple myeloma patients targeting monocyte differentiation and modulating mesenchymal stromal cell inhibitory properties
,null,
Oncotarget
,PubMed ID 28881793
[CRBN]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |