AHI1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ahi1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KDSTLRIMDLRILAARKFVGAANYREKIHSTLTPCGTLLFSGSEDGIVYV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	120 kDa
Gene Name	Abelson helper integration site 1
Database Link	NP_001128303 Entrez Gene 308923 Rat UniProt ID Q8N157
Background	Mutations in the human homolog are associated with Joubert syndrome, an autosomal recessive disorder resulting in severe mental retardation.
Synonyms	AHI-1; dJ71N10.1; JBTS3; ORF1
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.