SPATA7 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SPATA7 antibody: synthetic peptide directed towards the middle region of human SPATA7. Synthetic peptide located within the following region: FLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	68 kDa
Gene Name	spermatogenesis associated 7
Database Link	NP_060888 Entrez Gene 55812 Human UniProt ID Q9P0W8
Background	The function of the SPATA7 protein remains unknown.
Synonyms	HEL-S-296; HSD-3.1; HSD3; LCA3
Note	Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 92%; Dog: 86%; Zebrafish: 82%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.