RHOF Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RHOF antibody: synthetic peptide directed towards the middle region of human RHOF. Synthetic peptide located within the following region: DNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	ras homolog family member F (in filopodia)
Database Link	NP_061907 Entrez Gene 54509 Human UniProt ID Q9HBH0
Background	RHOF is a plasma membrane-associated small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. RHOF causes the formation of thin, actin-rich surface projections called filopodia. RHOF functions cooperatively with CDC42 and Rac
Synonyms	ARHF; RIF
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Goat: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.