C16orf61 (CMC2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C16orf61 antibody: synthetic peptide directed towards the middle region of human C16orf61. Synthetic peptide located within the following region: NILKFFGYCNDVDRELRKCLKNEYVENRTKSREHGIAMRKKLFNPPEESE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	9 kDa
Gene Name	C-x9-C motif containing 2
Database Link	NP_064573 Entrez Gene 56942 Human UniProt ID Q9NRP2
Background	The function of this protein remains unknown.
Synonyms	2310061C15Rik; C16orf61; DC13
Note	Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 79%; Horse: 79%; Mouse: 79%; Guinea pig: 79%; Rat: 77%; Bovine: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.