LYRM4 Rabbit Polyclonal Antibody
CAT#: TA344783
Rabbit Polyclonal Anti-Lyrm4 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Lyrm4 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 10 kDa |
Gene Name | LYR motif containing 4 |
Database Link | |
Background | Lyrm4 is required for nuclear and mitochondrial iron-sulfur protein biosynthesis. |
Synonyms | C6orf149; CGI-203; COXPD19; ISD11 |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |