PKIB Rabbit Polyclonal Antibody

CAT#: TA344652

Rabbit Polyclonal Anti-PKIB Antibody - middle region



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 2
    • 100 ug

CNY 3,080.00


Recombinant protein of human protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1, 100 µg
    • 100 ug

CNY 9,998.00


Transient overexpression lysate of protein kinase (cAMP-dependent, catalytic) inhibitor beta (PKIB), transcript variant 1
    • 100 ug

CNY 3,080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Rat
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-Pkib antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TDVESVISSFASSARAGRRNALPDIQSSLATGGSPDLALKLEALAVKEDA
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 12 kDa
Gene Name protein kinase (cAMP-dependent, catalytic) inhibitor beta
Background Pkib displays strong inhibition of the activity of cAMP-dependent protein kinase.
Synonyms PRKACN2
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 92%; Guinea pig: 92%; Dog: 90%; Horse: 90%; Bovine: 90%; Goat: 85%
Reference Data
Protein Families Druggable Genome
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...