PKM2 (PKM) Rabbit Polyclonal Antibody
CAT#: TA344600
Rabbit Polyclonal Anti-PKM2 Antibody - middle region
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PKM2 antibody: synthetic peptide directed towards the middle region of human PKM2. Synthetic peptide located within the following region: HLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSGRSAHQ |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 58 kDa |
Gene Name | pyruvate kinase, muscle |
Database Link | |
Background | This gene encodes a protein involved in glycolysis. The encoded protein is a pyruvate kinase that catalyzes the transfer of a phosphoryl group from phosphoenolpyruvate to ADP, generating ATP and pyruvate. This protein has been shown to interact with thyroid hormone and may mediate cellular metabolic effects induced by thyroid hormones. This protein has been found to bind Opa protein, a bacterial outer membrane protein involved in gonococcal adherence to and invasion of human cells, suggesting a role of this protein in bacterial pathogenesis. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported. |
Synonyms | CTHBP; HEL-S-30; OIP3; PK3; PKM2; TCB; THBP1 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Yeast: 85%; Sheep: 77% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Glycolysis / Gluconeogenesis, Metabolic pathways, Purine metabolism, Pyruvate metabolism, Type II diabetes mellitus |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |