PREB Rabbit Polyclonal Antibody

CAT#: TA344537

Rabbit Polyclonal Anti-PREB Antibody - N-terminal region



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (4)
Transient overexpression lysate of prolactin regulatory element binding (PREB)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human prolactin regulatory element binding (PREB), 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human prolactin regulatory element binding (PREB), 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-Preb antibody is synthetic peptide directed towards the N-terminal region of Mouse Preb. Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 45 kDa
Gene Name prolactin regulatory element binding
Background Preb was first identified based on its probable role in the regulation of pituitary gene transcription. It binds to the prolactin gene (PRL) promoter and seems to activate transcription. Guanine nucleotide exchange factor that activates SARA2. It is also required for the formation of COPII transport vesicles from the ER.
Synonyms SEC12
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%; Guinea pig: 86%
Reference Data
Protein Families Transcription Factors, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...